Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A075G1F4
dbSWEET id: dbswt_2028
Accession: A0A075G1F4
Uniprot status: Unreviewed
Organism: uncultured marine
Kingdom: Archaea
Sequence Information back to top
Sequence length: 96
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A075G1F4|A0A075G1F4_9ARCH|Unreviewed|uncultured marine|96
MELDETTMGVIGILAGILILSGWVPQIVRGYKTKRLNDVSPYLMILIFAGAVLWLIYGIA
LDDVYIMGVNLSAMVLTMIVLSMKLKYERLTQTTSE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 9 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A075G1F4_inward.pdb Alignment file: A0A075G1F4_inw.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 3.8% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A075G1F4_outward.pdb Alignment file: A0A075G1F4_out.pir Procheck score ⇒ Ramachandran plot: 93.9% favored 5.3% allowed .8% week .0% disallowed Occluded: Model structure: A0A075G1F4_occluded.pdb Alignment file: A0A075G1F4_occ.pir Procheck score ⇒ Ramachandran plot: 94.7% favored 3.8% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA