Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A075FLG3

dbSWEET id: dbswt_2026

Accession:   A0A075FLG3

Uniprot status:   Unreviewed

Organism:   uncultured marine

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ environmental samples.

Sequence Information back to top


Sequence length:   96

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A075FLG3|A0A075FLG3_9ARCH|Unreviewed|uncultured marine|96
MELDEITMGVIGILAGILILSGWVPQIVRGYKTKRLNDVSPYLMILIFAGAVLWLIYGIA
LDDVYIMGVNVAAMVLTMIVLSMKLKYERLAETTSE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A075FLG3_inward.pdb    Alignment file: A0A075FLG3_inw.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    4.5% allowed    2.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A075FLG3_outward.pdb    Alignment file: A0A075FLG3_out.pir

Procheck score ⇒ Ramachandran plot: 87.1% favored    12.1% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A075FLG3_occluded.pdb    Alignment file: A0A075FLG3_occ.pir

Procheck score ⇒ Ramachandran plot: 94.7% favored    4.5% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur