Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A072UGH8
dbSWEET id: dbswt_863
Accession: A0A072UGH8
Uniprot status: Unreviewed
Organism: Medicago truncatula
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.
Sequence Information back to top
Sequence length: 240
Substrate Binding Site: CIWN CVV: 469 CHI: 2.6
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A072UGH8|A0A072UGH8_MEDTR|Unreviewed|Medicago_truncatula|240
MVNALIVRDVVGLIGNVIYFGLLLSPIPTLVKIIKKRDVEEFKSDTYIAIVLNCAFWVFH
GLPFVHPDRILVVANVIGLNFSFDIINVIGLVLGFFYITIFYICANNEGRELLINKAFFF
GFVVLVTMFTLDDTNKRSLVVGIIFNFLNVIMYVSPLAVMENVIKTKSVKYMPFLPSLAI
FLNGLCWTTYALINPFDIYLLVSNGIGAISGFVQLILYVYFWCKGENKNDDANHDSDSAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 223
Alignment file: A0A072UGH8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A072UGH8_inward.pdb
Procheck score ⇒ Ramachandran plot: 85.9% favored 4.5% allowed 5.6% week 4.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A072UGH8_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 6.1% allowed .0% week 2.0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A072UGH8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 8.1% allowed 1.5% week .5% disallowed
Gene Informationback to top
Gene ID: 25495181 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA