Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A072UGH8

dbSWEET id: dbswt_863

Accession:   A0A072UGH8

Uniprot status:   Unreviewed

Organism:   Medicago truncatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.

Sequence Information back to top


Sequence length:   240

Substrate Binding Site:   CIWN           CVV:   469       CHI:   2.6

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|A0A072UGH8|A0A072UGH8_MEDTR|Unreviewed|Medicago_truncatula|240
MVNALIVRDVVGLIGNVIYFGLLLSPIPTLVKIIKKRDVEEFKSDTYIAIVLNCAFWVFH
GLPFVHPDRILVVANVIGLNFSFDIINVIGLVLGFFYITIFYICANNEGRELLINKAFFF
GFVVLVTMFTLDDTNKRSLVVGIIFNFLNVIMYVSPLAVMENVIKTKSVKYMPFLPSLAI
FLNGLCWTTYALINPFDIYLLVSNGIGAISGFVQLILYVYFWCKGENKNDDANHDSDSAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   223

Alignment file: A0A072UGH8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A072UGH8_inward.pdb

Procheck score ⇒ Ramachandran plot: 85.9% favored    4.5% allowed    5.6% week    4.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A072UGH8_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.1% allowed    .0% week    2.0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A072UGH8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.1% allowed    1.5% week    .5% disallowed

Gene Informationback to top


Gene ID:   25495181     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur