| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A072U6A4
dbSWEET id: dbswt_856
Accession: A0A072U6A4
Uniprot status: Unreviewed
Organism: Medicago truncatula
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.
Sequence Information back to top
Sequence length: 248
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A072U6A4|A0A072U6A4_MEDTR|Unreviewed|Medicago_truncatula|248
MVVTAKLARNVVGAIGNVISFGLFFSPAPTFYGIIKKKSVEEFKPDPYLATLLNCAFWVF
YGMPFVHPNSTLVLSINSVGILFEVVYLTIFFIYATKSGRKKLLLYLLIEAIFFAVIVLI
TMLALHGTKKRSLIVGVLCDVFNVMMYASPLTIMAKVIKTKSVKYMPFWLSLTNFLNGLC
WTTYALIHPLDIYVLVSNGIGVVSGIVQLILYACYFSRKGEEDDDGDGDFELKPTGVRDI
SSNGRATA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 217
Alignment file: A0A072U6A4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A072U6A4_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A072U6A4_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A072U6A4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.2% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 25495186 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA