Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A069ZLB0

dbSWEET id: dbswt_1308

Accession:   A0A069ZLB0

Uniprot status:   Unreviewed

Organism:   Porphyromonas

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Porphyromonas.

Sequence Information back to top


Sequence length:   126

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A069ZLB0|A0A069ZLB0_9PORP|Unreviewed|Porphyromonas| 126
MVGDLAGEAAWQSGRMRVFKSFYTFASDKIVFIHPKKYMAKSKFLTILGTVASVAAILMY
VSYISTIQGNLNGQKGDWIQPLVAAINCTLWVFYGLLQQPKRDWPIVIANAPGIVFGLAA
AITALM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   49     Model end:   126

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A069ZLB0_inward.pdb    Alignment file: A0A069ZLB0_inw.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A069ZLB0_outward.pdb    Alignment file: A0A069ZLB0_out.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    6.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A069ZLB0_occluded.pdb    Alignment file: A0A069ZLB0_occ.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.2% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur