Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A069QLC7
dbSWEET id: dbswt_1307
Accession: A0A069QLC7
Uniprot status: Unreviewed
Organism: Prevotella loescheii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 119
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|A0A069QLC7|A0A069QLC7_PRELO|Unreviewed|Prevotella loescheii| 119
MQTCVKVYHIKGDFCLFLKGIKYFCTFNNRLLEMKKEKFFGYVGWVGMCTSILMYVFYFP
QIQENLNGNKGSFIQPFMAGINCTLWVCYGLFKEKRDLPLVLANSPGVIFGFFAAFTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 44 Model end: 120 Inward Open: Template: 4X5M.pdb Model structure: A0A069QLC7_inward.pdb Alignment file: A0A069QLC7_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A069QLC7_outward.pdb Alignment file: A0A069QLC7_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 6.3% allowed .0% week .8% disallowed Occluded: Model structure: A0A069QLC7_occluded.pdb Alignment file: A0A069QLC7_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA