| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A069DQM6
dbSWEET id: dbswt_1003
Accession: A0A069DQM6
Uniprot status: Unreviewed
Organism: Panstrongylus megistus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Reduviidae ⇒ Triatominae ⇒ Panstrongylus.
Sequence Information back to top
Sequence length: 214
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QILV CVV: 467 CHI: 9
Fasta sequence:
>tr|A0A069DQM6|A0A069DQM6_9HEMI|Unreviewed|Panstrongylus_megistus|214
MGLEDYREVVGAAAGFATIAQCFSPVIICRDIIQQKDTHNVDPTPFIGGIGISLLMLQHG
LILNDPAMIPVNIIGLILNIIYLSVFYSYTKDKFNVFRSLGKVIAGVAVLITYAQLESKE
RIEFNFGIIVTVLLLILIAAPLFNLKEILRSKDTSSLPFPLISCGTVVTFLWLLYGITIK
NVFIQIQNVVGCTLCCIQLALCLMYPGKPRKKVE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 207
Alignment file: A0A069DQM6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A069DQM6_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.1% favored 7.7% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A069DQM6_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A069DQM6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.0% favored 7.7% allowed 2.2% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5