Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A069DQM6

dbSWEET id: dbswt_1003

Accession:   A0A069DQM6

Uniprot status:   Unreviewed

Organism:   Panstrongylus megistus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Reduviidae ⇒ Triatominae ⇒ Panstrongylus.

Sequence Information back to top


Sequence length:   214

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QILV           CVV:   467       CHI:   9

Fasta sequence:

>tr|A0A069DQM6|A0A069DQM6_9HEMI|Unreviewed|Panstrongylus_megistus|214
MGLEDYREVVGAAAGFATIAQCFSPVIICRDIIQQKDTHNVDPTPFIGGIGISLLMLQHG
LILNDPAMIPVNIIGLILNIIYLSVFYSYTKDKFNVFRSLGKVIAGVAVLITYAQLESKE
RIEFNFGIIVTVLLLILIAAPLFNLKEILRSKDTSSLPFPLISCGTVVTFLWLLYGITIK
NVFIQIQNVVGCTLCCIQLALCLMYPGKPRKKVE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A069DQM6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A069DQM6_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    7.7% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A069DQM6_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.7% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A069DQM6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.0% favored    7.7% allowed    2.2% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur