| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A068VK88
dbSWEET id: dbswt_217
Accession: A0A068VK88
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 278
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A068VK88|A0A068VK88_COFCA|Unreviewed|Coffea_canephora|278
MAQLAFIFGLLGNIVSFMVYLAPLPTFYSIYKKKSTEGFQSVPYVVGLFSAMLRIYYAFL
KPDTTLRITINSVGCFFQTVYLCYYLFYAPRRARIQTAKLLALLVVMGFGSIILLTQLLS
TGKTRARIVGWIGLVLSLCVFVAPLAIVRQVILTKSVEYMPFLPSFFLTLSAIMWFFYGF
LRQDYNIAIPNILGFFFGILQMVLYLIYKNAKKAVEQKLPEIQNQVIVLEEHKLPELQEQ
VIEVVKLSALVRPEIVSVISAQLNNENGMVKKITEPSS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A068VK88.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068VK88_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.9% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068VK88_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 5.9% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068VK88_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 5.4% allowed 2.2% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22