| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A068VC25
dbSWEET id: dbswt_489
Accession: A0A068VC25
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 242
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|A0A068VC25|A0A068VC25_COFCA|Unreviewed|Coffea_canephora|242
METLILFVGIIGNIISVLMFLSPAKTFWRIVKRKSTEDFESLPYICTLLNSSLWTYYGIT
RPGSYLVATVNGFGVVVEIIYVSLFLIFAPPKMKGKTAVLAGALDVGFLAAAILATQFLT
TGDTRIDVIGYMSSGLNIIMYGSPLAAMKTVVTTKSVEYMPFLLSFFLFLNGGIWTIYAV
LVQDWFLGVPNGIGFVLGTAQLVLYAIYRNAKPSYSASADLEQASERQSLLPPSASGHTS
HG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A068VC25.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068VC25_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 4.4% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068VC25_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.0% favored 3.3% allowed 1.7% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068VC25_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 4.4% allowed 2.2% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA