| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A068V9Q6
dbSWEET id: dbswt_461
Accession: A0A068V9Q6
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 272
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: MSMN CVV: 417 CHI: -0.5
Fasta sequence:
>tr|A0A068V9Q6|A0A068V9Q6_COFCA|Unreviewed|Coffea_canephora|272
MASFSVILGIIGNVISILMFLSPVKTFRRIVKKKSIEDFKGVPYITTLLSTSLWSFYGIL
KPGGLLVLTVNGAGAILHIIYVTLFLIYAPKDVKVKSLKLVAIVDVGFFGVVVAVTLLAL
HGSLRLTVVGLLCTGMTIGMYASPLSVMRTVIKMKSVEYMPFFLSFFQFLNGGVWAAYAV
LVKDIYLGVPNGIGFILGLAQLLLYVFYKNKYASKSKEAMEDGGGGSAHPIKGVIQMEDF
DNNEKMKTISLNQGAFGSTGSKDLELGVKDNL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A068V9Q6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068V9Q6_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.6% favored 2.8% allowed 1.1% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068V9Q6_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.0% favored 3.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068V9Q6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.0% favored 3.9% allowed .6% week .6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA