Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A068V525
dbSWEET id: dbswt_417
Accession: A0A068V525
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 275
Substrate Binding Site: ANWT CVV: 419 CHI: -3.3
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|A0A068V525|A0A068V525_COFCA|Unreviewed|Coffea_canephora|275
MPLFPIQNPWVFALGVIGNLVSFLVYLAPVPTFRRIVKKKSTEGFHSFPYVVSLFSAMLW
VDYARVKSNVLLVTVNSIGCLIETIYIAFFIVHAPKKPRMFTLKLVILLNFIGFGSICIL
TEYLAKGARKTQALGWLCVASSAMVYIAPLSVMKQVISTRSVEFMPFWLSFSLVLNSLTW
CSYGLLLKDIHITVPTVVGFIFGMIQMALYVTYKNIKMKPEEPKLPTIVKPITIIPSEML
PLGSLPIDDTNKAKNEKVQEQIQQGEREQDASHQV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 215
Alignment file: A0A068V525.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068V525_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.4% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068V525_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.4% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068V525_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.3% allowed 1.1% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22