Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A068V525

dbSWEET id: dbswt_417

Accession:   A0A068V525

Uniprot status:   Unreviewed

Organism:   Coffea canephora

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.

Sequence Information back to top


Sequence length:   275

Substrate Binding Site:   ANWT           CVV:   419       CHI:   -3.3

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|A0A068V525|A0A068V525_COFCA|Unreviewed|Coffea_canephora|275
MPLFPIQNPWVFALGVIGNLVSFLVYLAPVPTFRRIVKKKSTEGFHSFPYVVSLFSAMLW
VDYARVKSNVLLVTVNSIGCLIETIYIAFFIVHAPKKPRMFTLKLVILLNFIGFGSICIL
TEYLAKGARKTQALGWLCVASSAMVYIAPLSVMKQVISTRSVEFMPFWLSFSLVLNSLTW
CSYGLLLKDIHITVPTVVGFIFGMIQMALYVTYKNIKMKPEEPKLPTIVKPITIIPSEML
PLGSLPIDDTNKAKNEKVQEQIQQGEREQDASHQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   215

Alignment file: A0A068V525.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A068V525_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.4% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A068V525_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.4% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A068V525_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.3% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur