Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A068V1B2

dbSWEET id: dbswt_673

Accession:   A0A068V1B2

Uniprot status:   Unreviewed

Organism:   Coffea canephora

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.

Sequence Information back to top


Sequence length:   238

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|A0A068V1B2|A0A068V1B2_COFCA|Unreviewed|Coffea_canephora|238
MTIQQTGFISTYSALSEAAGVAGNFFAFVLFVSPVPTFRRIIRRQSTEQFSGLPYVYALL
NCLICLWYGMPIISPGIILVATVNSVGAIFQMIYIIIFIAYAERGKKVKMLGLLLAVFAV
FSIIICVSLKFFEPPNRQLFVGYLSVLSLISMFASPLFIINLVIKTKSVEYMPFYLSLAT
FLMSLSFFGYGMFKQDLFISVPNGIGGLLGIIQLVLYFCYSRSSDGGRPRAPLLESYA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   222

Alignment file: A0A068V1B2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A068V1B2_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.7% favored    3.8% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A068V1B2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A068V1B2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    4.8% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur