Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A068V1B2
dbSWEET id: dbswt_673
Accession: A0A068V1B2
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 238
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A068V1B2|A0A068V1B2_COFCA|Unreviewed|Coffea_canephora|238
MTIQQTGFISTYSALSEAAGVAGNFFAFVLFVSPVPTFRRIIRRQSTEQFSGLPYVYALL
NCLICLWYGMPIISPGIILVATVNSVGAIFQMIYIIIFIAYAERGKKVKMLGLLLAVFAV
FSIIICVSLKFFEPPNRQLFVGYLSVLSLISMFASPLFIINLVIKTKSVEYMPFYLSLAT
FLMSLSFFGYGMFKQDLFISVPNGIGGLLGIIQLVLYFCYSRSSDGGRPRAPLLESYA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 9 Model end: 222
Alignment file: A0A068V1B2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068V1B2_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.8% allowed .5% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068V1B2_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068V1B2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.8% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA