| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A068V0H7
dbSWEET id: dbswt_148
Accession: A0A068V0H7
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 302
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: ASVS CVV: 318 CHI: 4.4
Fasta sequence:
>tr|A0A068V0H7|A0A068V0H7_COFCA|Unreviewed|Coffea_canephora|302
MASFGSDHHRWVFAFGVLGNLVSVIAYLGPLPTFYRIYREKSTMGYEALPYVVALSSAML
WMYYALLKPATLLISINSLGCIIETLYILFYILYASKQARKHTIKLVGMLNVGLICAIFV
VANFALKEVSVRIMVVGWICVAFSVSVFAAPLSIVFQVVRTRNAEFMPVALSATLTLSAV
MWFFYGFLKADMCVTVPNIMGFFLGVLQMMLYVIYRKPKPLVAEKKVPEHVINIVMLCNS
DVHPVVDSQTSGNCDVNSTADADENEDEKKDEETVSAVADEPCSSQAQVHLDSPALLVCS
AA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 217
Alignment file: A0A068V0H7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068V0H7_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 6.2% allowed 1.0% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068V0H7_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.8% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068V0H7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.3% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA