| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A068UUL0
dbSWEET id: dbswt_687
Accession: A0A068UUL0
Uniprot status: Unreviewed
Organism: Coffea canephora
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Gentianales ⇒ Rubiaceae ⇒ Ixoroideae ⇒ Coffeeae ⇒ Coffea.
Sequence Information back to top
Sequence length: 248
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|A0A068UUL0|A0A068UUL0_COFCA|Unreviewed|Coffea_canephora|248
MKEIAHFVFGVFGNASALFLFLAPVITFRRIIIKRSTEQFSGVPYVMTLLNCLLSAWYGL
PFVSPHNLPVSTINGTGAAIEFIYVLIFLIFAPKKEKTKIFSILVLVITAFAAVALVSLF
VLHGQSRKLFCGLAATIFSITMYASPLTIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFIF
GLLGRDPFVAIPNGFGSGLGTVQLILYAIYHDNKGPGKREVSDASSQLKDLENGKPQEEK
QTPGDEQV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 212
Alignment file: A0A068UUL0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A068UUL0_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A068UUL0_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 2.7% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A068UUL0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.3% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA