Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A067RAA7

dbSWEET id: dbswt_1002

Accession:   A0A067RAA7

Uniprot status:   Unreviewed

Organism:   Zootermopsis nevadensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Orthopteroidea ⇒ Dictyoptera ⇒ Isoptera ⇒ Termopsidae ⇒ Zootermopsis.

Sequence Information back to top


Sequence length:   217

Substrate Binding Site:   GNWN           CVV:   403       CHI:   -8.3

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|A0A067RAA7|A0A067RAA7_ZOONE|Unreviewed|Zootermopsis_nevadensis|217
MALEDYKDVVATAASIMTTAQFFAGMFICKDIVKKGSTENVSGAPFIGGSAMGILMMQYS
NILNDPAMTRVNIVGVTLNLGYLLCYYIYSENKRELQKQIFYTTAFVAALIAYVFWENPD
FVEFRYGLIITTLFMLLIASPLLSLGDVIRTKSTEMLPFPLILSGTVVTFLWLLYGIIIK
NSFIQFQNAVGFTLFSIQLSLFAIYPSRPQKKDKKKQ

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A067RAA7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A067RAA7_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    8.1% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A067RAA7_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.0% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A067RAA7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.0% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur