| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A067JV29
dbSWEET id: dbswt_494
Accession: A0A067JV29
Uniprot status: Unreviewed
Organism: Jatropha curcas
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Crotonoideae ⇒ Jatropheae ⇒ Jatropha.
Sequence Information back to top
Sequence length: 238
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|A0A067JV29|A0A067JV29_JATCU|Unreviewed|Jatropha_curcas|238
MEGLILFVGVIGNIISVLMFLSPVGTFWRIIKNRSTEDFESVPYVCTLLNAALWTYYGII
KPGAFLVATVNGFGILVEIIFVTLFLIYAPPKMKAKTWILVGLLDVGFLATAIVVTRLAL
KGEVRIDATGFICSGLNIVMYASPLAVMKTVVTTKSVEFMPFFLSFFLFLNGAVWTLYAF
LTSDYFLGVPNGTGFLLGTAQLVLYAIYRNAKPAPRNVSDGLEEGSQHDRLITPRENP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A067JV29.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A067JV29_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 4.4% allowed .6% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A067JV29_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.6% favored 3.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A067JV29_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 4.4% allowed .6% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA