Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A067JPC7
dbSWEET id: dbswt_468
Accession: A0A067JPC7
Uniprot status: Unreviewed
Organism: Jatropha curcas
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Crotonoideae ⇒ Jatropheae ⇒ Jatropha.
Sequence Information back to top
Sequence length: 245
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VNAN CVV: 364 CHI: -1
Fasta sequence:
>tr|A0A067JPC7|A0A067JPC7_JATCU|Unreviewed|Jatropha_curcas|245
MAGLSISKASLVVILGLLGNITTGLVYLAPVKTFWRIVVNRSTEEFESAPYMFKLLNAYF
WVYYGIIKPNSILVATVNGFGAVLEIIFVSLFLIFVPPRLRVKTAILAGVLDVVFPGAVV
VAAQLLLKEEKRIDVAGFFCVCFSMAAYGSPLSAMKTVITSKSVEYMPFLLSFFLFINGG
VWTFYAIITNDWFIGLPNGTGFGLGTAQLILYAIYYKRPQPWKKSSNKLEEECLIPENQR
ITAKD
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 217
Alignment file: A0A067JPC7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A067JPC7_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 2.7% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A067JPC7_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A067JPC7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.4% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 105645443 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA