| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A067H794
dbSWEET id: dbswt_711
Accession: A0A067H794
Uniprot status: Unreviewed
Organism: Citrus sinensis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 214
Substrate Binding Site: CNWF CVV: 480 CHI: 0.9
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|A0A067H794|A0A067H794_CITSI|Unreviewed|Citrus_sinensis|214
MDIAHFLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLP
FVSKNNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVFAAVALVSLLA
FHGNARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFVFG
LLGRDPFVAVSFIFFDLTVLEFWRIMIILVHFMF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A067H794.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A067H794_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A067H794_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A067H794_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.7% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA