| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A067GH50
dbSWEET id: dbswt_671
Accession: A0A067GH50
Uniprot status: Unreviewed
Organism: Citrus sinensis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 264
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A067GH50|A0A067GH50_CITSI|Unreviewed|Citrus_sinensis|264
MSSVGISSIYSGCSVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNC
LITLWYGMPLVSPGIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFL
AIVFTSMEVFDSNGRRLFVGYLSVASLISMFASPLFIIVSSSGTQAFRLLRLHISLHSYG
CMYIFMQKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGMFKDDPFIYVPNGIGTLLGIAQ
VMLYSYYSTKSGEVSRQPLIDSFA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 249
Alignment file: A0A067GH50.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A067GH50_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 4.7% allowed .9% week 1.9% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A067GH50_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 7.9% allowed 2.3% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A067GH50_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 7.9% allowed 1.9% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA