Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A067E5Z3
dbSWEET id: dbswt_625
Accession: A0A067E5Z3
Uniprot status: Unreviewed
Organism: Citrus sinensis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A067E5Z3|A0A067E5Z3_CITSI|Unreviewed|Citrus_sinensis|235
MILTITYQALTVLKDAVGIAGNIFAFGLFVSPVPTFRRIIRNHSTEEFSGLPYVYALLNC
LITMWYGTPLVSADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLLLAVIGIFS
IIVAVSLQIVNPFSRQMFVGLLSCAALISMFASPLFIINLVIQTKSVEFMPFYLSLSTFL
MSTSFLAYGIMNWDPFIYVPNGIGTILGIVQLALYFNYKETSGEESRDPLIVSYA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: A0A067E5Z3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A067E5Z3_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.7% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A067E5Z3_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A067E5Z3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 6.3% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA