| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A067DKU5
dbSWEET id: dbswt_457
Accession: A0A067DKU5
Uniprot status: Unreviewed
Organism: Citrus sinensis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 308
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>tr|A0A067DKU5|A0A067DKU5_CITSI|Unreviewed|Citrus_sinensis|308
MASLSFFVGIIGNVISLLVFASPIKTFWQIVKKKSTESYKGVPYITTLMSTCLWTFYGVM
KPGGLVVATVNGAGAALQFIYVSLYLIYAPKDKKVKTAKLVAILDVGFLGAVIAITLLAM
HGNLRLTFVGILCAALTIGMYASPLAVMTTVIRTKSVKYMPFLLSFFLFLNAGVWSVYSV
LVKDIYIGVPNAVGFVLGAAQLILYMIYKNKTPLPTKSMDSVKERSAHKVKDGIEMGARG
DDHDNQEDDLEEANGKKKRTLRQGKSLPKPTLGKQFSIPKILKKTASLGPYDLYSSWYHH
YDDSDVDA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A067DKU5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A067DKU5_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 3.3% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A067DKU5_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 5.5% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A067DKU5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 5.5% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA