Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A066WUB9

dbSWEET id: dbswt_1305

Accession:   A0A066WUB9

Uniprot status:   Unreviewed

Organism:   Flavobacterium seoulense

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Flavobacterium.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   VLVL           CVV:   458       CHI:   16

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A066WUB9|A0A066WUB9_9FLAO|Unreviewed|Flavobacterium seoulense|86
MEFIDVLGFFAGICVTISVIPQIWKVWKTKKVKDISLLTFSILTFGVALWVVYGVLKNDL
PIIVTNSISLTLNLLMVYFIVYYEKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A066WUB9_inward.pdb    Alignment file: A0A066WUB9_inw.pir

Procheck score ⇒ Ramachandran plot: 89.0% favored    8.9% allowed    1.4% week    .7% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A066WUB9_outward.pdb    Alignment file: A0A066WUB9_out.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.5% allowed    2.1% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A066WUB9_occluded.pdb    Alignment file: A0A066WUB9_occ.pir

Procheck score ⇒ Ramachandran plot: 91.1% favored    5.5% allowed    1.4% week    2.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur