Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A062XBP4
dbSWEET id: dbswt_1302
Accession: A0A062XBP4
Uniprot status: Unreviewed
Organism: Leuconostoc pseudomesenteroides
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A062XBP4|A0A062XBP4_LEUPS|Unreviewed|Leuconostoc pseudomesenteroides|86
MKNDKFIKYLSWTATIMSIMMYVSYIPQILNNLSGSKGNPVQPLVAAVNCALWVTYGLIK
EDRDLPLAAANFPGIIFGIVTFWTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A062XBP4_inward.pdb Alignment file: A0A062XBP4_inw.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 10.9% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A062XBP4_outward.pdb Alignment file: A0A062XBP4_out.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 8.6% allowed 4.7% week .0% disallowed Occluded: Model structure: A0A062XBP4_occluded.pdb Alignment file: A0A062XBP4_occ.pir Procheck score ⇒ Ramachandran plot: 87.5% favored 9.4% allowed 1.6% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA