Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A061G6B6

dbSWEET id: dbswt_426

Accession:   A0A061G6B6

Uniprot status:   Unreviewed

Organism:   Theobroma cacao

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.

Sequence Information back to top


Sequence length:   285

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A061G6B6|A0A061G6B6_THECC|Unreviewed|Theobroma_cacao|285
MAYHPWIIVSGILGNILSFMVYLAPLPTFLRVYRKKSTEGFQSIPYVVALVSAALWIYYA
TLKSNAFLLMTINSFGCFVETIYTVVFIIYAPKKARILTMKLLLLFNFGGLLLILLLTHF
FSKGPSRIHIVGWFCVVSSAGVFAAPLSIMRLVVRTKSVEFMPFALSFFLTLSAIMWLIY
GVLLKDFYISLPNIIGVVLGMIQMVLFVVYKKYKNIENEQKQLPVQVANGKNLAPIKASN
NTDSSLQVSGDVGVGRDENPHDHPLQHSHKSMESTNQAEPGECAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: A0A061G6B6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A061G6B6_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.8% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A061G6B6_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A061G6B6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.3% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur