Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A061G239

dbSWEET id: dbswt_576

Accession:   A0A061G239

Uniprot status:   Unreviewed

Organism:   Theobroma cacao

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.

Sequence Information back to top


Sequence length:   255

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|A0A061G239|A0A061G239_THECC|Unreviewed|Theobroma_cacao|255
MGERLRLGVGIMGNASSLLLYAAPILTFSRVIRKRSTEDFSCIPYIGALLNCLLYTWYGL
PVVSYKWENFPLVTINGLGIILELSFIFIYFWFASTRGKIKVGVITTPVILVSCIIAIIS
AFVFHDHHHRKAFVGTVGLVASVAMYCAPLVAVKQVILTKSVEFMPFYLSLASFLASVLW
LAYGLLSHDLLLASPNLVGCPIGVLQLVLHCKYRKRGIMEEPSKWDLEQNSQEKPKQMQF
VMNENINEKELKNTA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: A0A061G239.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A061G239_inward.pdb

Procheck score ⇒ Ramachandran plot: 84.6% favored    9.0% allowed    4.3% week    2.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A061G239_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.9% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A061G239_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.3% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   18605721     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur