Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A061G064
dbSWEET id: dbswt_194
Accession: A0A061G064
Uniprot status: Unreviewed
Organism: Theobroma cacao
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.
Sequence Information back to top
Sequence length: 281
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVG CVV: 331 CHI: 7.2
Fasta sequence:
>tr|A0A061G064|A0A061G064_THECC|Unreviewed|Theobroma_cacao|281
MALHLSWAFVFGVLVGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIY
YALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLST
FFLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWF
FYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLSEHIVDVVKLGT
MVCSEVNAVAPQPNETNNNGGVVQAQNIKGNTTDHDASNKV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: A0A061G064.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A061G064_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.7% allowed 1.0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A061G064_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 3.1% allowed 2.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A061G064_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.2% allowed 1.0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22