Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A061G064

dbSWEET id: dbswt_194

Accession:   A0A061G064

Uniprot status:   Unreviewed

Organism:   Theobroma cacao

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.

Sequence Information back to top


Sequence length:   281

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVG           CVV:   331       CHI:   7.2

Fasta sequence:

>tr|A0A061G064|A0A061G064_THECC|Unreviewed|Theobroma_cacao|281
MALHLSWAFVFGVLVGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIY
YALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLST
FFLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWF
FYGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLSEHIVDVVKLGT
MVCSEVNAVAPQPNETNNNGGVVQAQNIKGNTTDHDASNKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: A0A061G064.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A061G064_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.7% allowed    1.0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A061G064_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    3.1% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A061G064_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.2% allowed    1.0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur