| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A061FZ85
dbSWEET id: dbswt_195
Accession: A0A061FZ85
Uniprot status: Unreviewed
Organism: Theobroma cacao
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.
Sequence Information back to top
Sequence length: 280
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVG CVV: 331 CHI: 7.2
Fasta sequence:
>tr|A0A061FZ85|A0A061FZ85_THECC|Unreviewed|Theobroma_cacao|280
MALHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYY
ALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTF
FLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFF
YGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLSEHIVDVVKLGTM
VCSEVNAVAPQPNETNNNGGVVQAQNIKGNTTDHDASNKV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: A0A061FZ85.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A061FZ85_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 5.7% allowed .0% week 2.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A061FZ85_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.2% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A061FZ85_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 3.6% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22