| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A061F4B5
dbSWEET id: dbswt_471
Accession: A0A061F4B5
Uniprot status: Unreviewed
Organism: Theobroma cacao
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.
Sequence Information back to top
Sequence length: 302
Substrate Binding Site: GNWN CVV: 403 CHI: -8.3
Selectivity Filter: VNTN CVV: 390 CHI: -3.5
Fasta sequence:
>tr|A0A061F4B5|A0A061F4B5_THECC|Unreviewed|Theobroma_cacao|302
MSSSLTSLVPSDVKTLSEFGNFREHSNPNIAVDLQSKNLHTSSEFFFLQPVYSLSMVTLV
TIFGLLGNITTGLVYLSPAKTFWHIVQRGSTEEFDSLPYVVKLLNGYMWVYYGLVKPNSI
LVATINGFGAVLELIYVIIFLILAPPRMRVITAILFGILDVVFPVAVVLISQLSFNREMQ
INISGFLSLLFSVATYGSPLSIMKTVVTTKSVEYMPFLLSFILFINGLTWTVYAVLTRDW
FIGIPNGSGFVLGTAQLVLYAMYWKPKQPKRTSDNVEDDWQHEHLIADSGPSLKNNESRA
DA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 53 Model end: 265
Alignment file: A0A061F4B5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A061F4B5_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.2% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A061F4B5_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 3.8% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A061F4B5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA