Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A061ENY4

dbSWEET id: dbswt_502

Accession:   A0A061ENY4

Uniprot status:   Unreviewed

Organism:   Theobroma cacao

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Byttnerioideae ⇒ Theobroma.

Sequence Information back to top


Sequence length:   237

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VNMN           CVV:   421       CHI:   -0.9

Fasta sequence:

>tr|A0A061ENY4|A0A061ENY4_THECC|Unreviewed|Theobroma_cacao|237
MVGSSFIVGVVGNVISVLVFLSPIGTFWRIIKRQSTEDFESLPYICTLLNSSLWTYYGIT
KPGGLLVATVNGFGILVEAVYVVLFLIYAPKKMRVKTGILVGILDVGFLAAAIVVTQLAL
TGETRIDAIGFMCAGLNIIMYGSPLAAMKTVVTTKSVEYMPFFLSFFLFLNGGIWAFYAL
LVQDYFLGIPNGIGFLLGTAQLLLYAIYRNGKPSSNNISEGLMEQGWPTEPLISPLH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: A0A061ENY4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A061ENY4_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    3.9% allowed    1.1% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A061ENY4_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.5% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A061ENY4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.5% allowed    .6% week    .6% disallowed

Gene Informationback to top


Gene ID:   18603529     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur