| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059DFJ7
dbSWEET id: dbswt_583
Accession: A0A059DFJ7
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 290
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMS CVV: 417 CHI: 1.4
Fasta sequence:
>tr|A0A059DFJ7|A0A059DFJ7_EUCGR|Unreviewed|Eucalyptus_grandis|290
MASNVDALDSLRVSLVSVDTPPFVLGFVVCFRQRKSMGDRLRLAIGVLGNAASLLLYAAP
ILTFARIIKRKSTEEFSCIPYILALWNCLLYTWYGLPVVSYRWENFPVVTVNGVGILLEI
SFIAIYFWLTSTKQKIKVAAMALGVLTFFIIIAIVSTFIFHDHHHRKVFVGSIGLVASVA
MYGSPLVAVKQVIKTKSVEFMPFYLSLFSFISSSLWLAYGLLSHDLFLASPNLVGSPMGV
LQLILYCKYRQRGVVEGPSKWDLESNGDRNKSKQLQLAENDHVTDPKCPS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 35 Model end: 251
Alignment file: A0A059DFJ7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059DFJ7_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.2% allowed 1.0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059DFJ7_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 3.6% allowed 2.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059DFJ7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 6.7% allowed 2.1% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA