Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A059CHE1

dbSWEET id: dbswt_817

Accession:   A0A059CHE1

Uniprot status:   Unreviewed

Organism:   Eucalyptus grandis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.

Sequence Information back to top


Sequence length:   215

Substrate Binding Site:   CNWT           CVV:   438       CHI:   -2.6

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|A0A059CHE1|A0A059CHE1_EUCGR|Unreviewed|Eucalyptus_grandis|215
MVSADAARTAVGVLGNAIALFLFLSPMPTFIRIWKKGSVEQYSPVPYLATLINCIVWVLY
GLPMVHPHSTLVVTINGAGTLIEVVYILLFLLYSDRQKRLRVAAVVLIELVFISALVALV
LTLVHTHERRSMVVGIVCMVFNIMMYASPLSVMKLVITTKSVEYMPFFLSLASFANGLCW
TAYALIRFDLFIAVITLFLSLSRCFVMVRPKRVRY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: A0A059CHE1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A059CHE1_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.6% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A059CHE1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.9% favored    3.6% allowed    1.5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A059CHE1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.1% allowed    .0% week    1.5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur