Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A059CDJ7

dbSWEET id: dbswt_668

Accession:   A0A059CDJ7

Uniprot status:   Unreviewed

Organism:   Eucalyptus grandis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.

Sequence Information back to top


Sequence length:   235

Substrate Binding Site:   SNFN           CVV:   400       CHI:   -5

Selectivity Filter:   LNMT           CVV:   437       CHI:   1.5

Fasta sequence:

>tr|A0A059CDJ7|A0A059CDJ7_EUCGR|Unreviewed|Eucalyptus_grandis|235
MLPNSCLPANSICSAAAGIAGNVFALVLFMSPILTFRRIVRNQSTEQFSGSPYIYTLLNS
LICLWYGLPLVSPGVIMVATVNGVGVVFQAVYITIFIVYASKARKLKMLGLSISVLVLFL
VMVIISLQFFDSHSRQIFVGYLSVASLISMFASPLFIIKLVIKTRSVEYMPFYLSFSTFL
TSLSFLAYGLFKADPFIYFPNGIGTILGIIQLALYFYYKNVSTVHLREPLINSCA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   220

Alignment file: A0A059CDJ7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A059CDJ7_inward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A059CDJ7_outward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A059CDJ7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    6.3% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   104440835     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur