| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059BZS1
dbSWEET id: dbswt_689
Accession: A0A059BZS1
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 243
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|A0A059BZS1|A0A059BZS1_EUCGR|Unreviewed|Eucalyptus_grandis|243
MHVLLFLSGVLGNATGLFLFLAPMVTFKRIIRNRSTEQFSGIPYVMTLLNCIVFTWYGLP
FVSRNNILIWTINATGGVIEFTYIVIFIIFGPKKERMKVMGLFALIMTVFSAIASISLLA
LHGNTRKFFCGVAAALFSTVMFASPLSVMRMVIKTKSVEFMPFFLSLFAFLCALSWLIYG
LLSGDPFVLVPNVFGTGLGIAQLILYAIYYKNRNHSESAIKDDFIEMDLENIDQVKKPDS
RHL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A059BZS1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059BZS1_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 2.7% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059BZS1_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 4.3% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059BZS1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 5.4% allowed .0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA