| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059BW86
dbSWEET id: dbswt_654
Accession: A0A059BW86
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 241
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A059BW86|A0A059BW86_EUCGR|Unreviewed|Eucalyptus_grandis|241
MIGLYSLSVSVITICKDAAGAAGNIFAIGLFVSPIPTFRRIIRNQSTEQFSGLPYIYALL
NCLLCTWYGTPLISSNNMLVMTVNFTGALFQLAYIVLYVTYADKQKKQMMMLGLLSAVLA
IFAIIVVTSLHIPDADLRRDIVGIISGVSLISMLASPLLIINLVIRTKSVEFMPFYLSLS
MFLMSASFTLYGSFNDDIFIYVPNGIGTILGITQLVLYCHYKRTGSESSKEPLIESYEET
T
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 9 Model end: 223
Alignment file: A0A059BW86.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059BW86_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 5.2% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059BW86_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 4.7% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059BW86_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA