| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059BNE3
dbSWEET id: dbswt_655
Accession: A0A059BNE3
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 241
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A059BNE3|A0A059BNE3_EUCGR|Unreviewed|Eucalyptus_grandis|241
MGVEGAMTPVHLYFVSRICKDAAGAAGNIFAIGLFVSPLPTFKRIVRNKSTEHFSGLPYI
YALLNCLICMWYGSPFVSDDNLLVMTVNSAGAVFQFVYIILFITFADRANKVRMTGFLLA
IIGAFAVVVAGSLQIPEPALRRITVGSLSGASLISMFASPLFAINLVIRTKSVEFMPFYL
SLSTFLMSTSFLLYGLFNDDVFIYVPNGIGTVLGITQLVLYFYFKRRPKDKLKEPLVEPI
A
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 226
Alignment file: A0A059BNE3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059BNE3_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059BNE3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.3% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059BNE3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 6.4% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 104448611 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA