| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059B7N9
dbSWEET id: dbswt_144
Accession: A0A059B7N9
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 263
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A059B7N9|A0A059B7N9_EUCGR|Unreviewed|Eucalyptus_grandis|263
MIGNIVSFFVFLAPVPTFYRICRNKSTEEFQSIPYLVALFSSMLWLYYAFLKGHSFLLIT
INSFGCVIEMVYIAIYIAYALRAARNSTIKLFALMNMGLFSLLILITHFIPNNDARATVF
GWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKDWCIMI
PNIVGFVLGLSQMVVYGYYRNNEVMDEKLPQHVAITVVHPPPGGVSEVRPVTPNEQQPQP
SQLPEGAVEVVVSGDDLGSDQPS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 201
Alignment file: A0A059B7N9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059B7N9_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 5.0% allowed 1.1% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059B7N9_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.1% allowed 1.7% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059B7N9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.6% favored 8.8% allowed .0% week .6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA