| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059B789
dbSWEET id: dbswt_141
Accession: A0A059B789
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 244
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A059B789|A0A059B789_EUCGR|Unreviewed|Eucalyptus_grandis|244
MIGNIVSLFVFFAPVPTFYRIYKEKSTEGFQSIPYLVALFSSMLWLYYAFLKGHSFLLIT
INSFGCVIEMVYIAIYIAYALRAARSSTIKLFALMNVGLFSLLILIIHFIPNGDARTTVF
GWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKDWCIMI
PNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEKLPQHVVHPTSGRASVVHPVTVEISL
PING
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 201
Alignment file: A0A059B789.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059B789_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.6% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059B789_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.6% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059B789_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 6.2% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA