| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059B753
dbSWEET id: dbswt_469
Accession: A0A059B753
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 212
Substrate Binding Site: ANWL CVV: 450 CHI: 1.2
Selectivity Filter: INAN CVV: 383 CHI: -0.7
Fasta sequence:
>tr|A0A059B753|A0A059B753_EUCGR|Unreviewed|Eucalyptus_grandis|212
MTVSFFFGVLGNVTTGLIYLAPVKTFWHILKRRSTEEFESIPYVFKLLNAYFWTYYGIVK
PDSVVVATVNGFGVVVEIIFVAIFLLYAPPRMRKRTAILAVTCDVMFPAAAILVTQLTLD
RQMQIIVAGLLSAVFSMVAYGSPLSAMKTVVTTKSVEYMPFLLSFALFINGGVWTVYAIL
TQDYFIGVSLISSFSSTFGFSIVFSTIGRNDY
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: A0A059B753.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059B753_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.3% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059B753_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 5.4% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059B753_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA