Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A059B6W6

dbSWEET id: dbswt_470

Accession:   A0A059B6W6

Uniprot status:   Unreviewed

Organism:   Eucalyptus grandis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.

Sequence Information back to top


Sequence length:   244

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   INAN           CVV:   383       CHI:   -0.7

Fasta sequence:

>tr|A0A059B6W6|A0A059B6W6_EUCGR|Unreviewed|Eucalyptus_grandis|244
MTVSFFFGVLGNVTTGLIYLAPVKTFWHILKRRSTEEFESIPYVFKLLNAYFWTYYGIVK
PDSVVVATVNGFGVVVEIIFVAIFLLYAPPRMRKRTAILAVTCDVMFPAAAILVTQLTLD
RQMQIIVAGLLSAVFSMVAYGSPLSAMKTVVTTKSVEYMPFLLSFALFINGGVWTVYAIL
TQDYFIGIPNGTGFGLGTAQMILYAMYYKPRTKSSSAEDKVGQPDEPLIDPTSVPQAVVA
QEKD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: A0A059B6W6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A059B6W6_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.9% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A059B6W6_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.4% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A059B6W6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.1% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   104415615     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur