Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A059B6R9

dbSWEET id: dbswt_143

Accession:   A0A059B6R9

Uniprot status:   Unreviewed

Organism:   Eucalyptus grandis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.

Sequence Information back to top


Sequence length:   276

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A059B6R9|A0A059B6R9_EUCGR|Unreviewed|Eucalyptus_grandis|276
MIGNIVSFFVFLAPMPTFYRIYRNKSTEEFQSIPYLVALFSSMLWLYYAFLKGHSFLLIT
INSFGCVIEMVYIAIYIAYALTAARNSTIKLFALMNMGLFSLLILITHFIPNDDARAMVF
GWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKDWCIMI
PNTVGFVLGLSQMVVYGYYRNNEVMDEKLPQHVAITVVRPPLGGVSEVRPVTDEISPPID
RGEARADEQQPQPSQLPKGAMEVVVSGDDLESDQPS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   201

Alignment file: A0A059B6R9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A059B6R9_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.1% allowed    1.1% week    .6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A059B6R9_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    8.3% allowed    1.1% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A059B6R9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    7.2% allowed    1.1% week    .6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur