| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059A6T7
dbSWEET id: dbswt_420
Accession: A0A059A6T7
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 284
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A059A6T7|A0A059A6T7_EUCGR|Unreviewed|Eucalyptus_grandis|284
MAIFSTDNPWAFAFGLLGNLISFMVFLAPVPTFYGVCKRKSTEGFQSVPYVVSLLSAMLW
LYYASINSESNDFLLVTVNSVGCVIETIYVALYLAYAPKKAKIFTAKLMVMGFGGFCSFI
LLSRFLTEGSTRVQLLGWLCVGFSVIVFAAPLSVMRMVIRTKSVEFMPFSLSFFLTLSAV
TWLLYGIFLKDIHIAVPNVLGFILGVLQMGLYLIYRKRNIMVLEKPDYLGGAKPIANTQS
CSIASNDNVIHVDEVKERKEDVHEGEKSSEASDNEQVANSSCEV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A059A6T7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059A6T7_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 2.7% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059A6T7_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059A6T7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 104427778 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22