Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A059A5X7
dbSWEET id: dbswt_418
Accession: A0A059A5X7
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 264
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A059A5X7|A0A059A5X7_EUCGR|Unreviewed|Eucalyptus_grandis|264
MAIFSTDNPWAFAFGLLGNLISFVVFLAPVPTFYRVCKRKSTEGFQSVPYVVSLLSAMLW
LYYASINSESNDFLLFTVNSVGCVIETIYVALYLAYAPKKAKIFTVKLMVTGFGGFCSFL
LLSRFLTKGSTRVQLLGWLCVGFSIIVFGAPLSVMRMVIRAKSVEFMPFSLSFSLTLSAV
TWLLYGLFLKDIHIVVPNVLGFILGVLQMGLYLIYRKRNVMVLEEPHYLGGAKPITDTQS
CNVASDDVTIDVDEVKERKDDVYE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A059A5X7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059A5X7_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 3.2% allowed 2.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059A5X7_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.8% favored 2.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059A5X7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22