Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A059A5R8
dbSWEET id: dbswt_422
Accession: A0A059A5R8
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 265
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A059A5R8|A0A059A5R8_EUCGR|Unreviewed|Eucalyptus_grandis|265
MAIFTTENPWVLIFGVLGNIISIVVFLAPVPTFCRICRTKSTEEFESVPYVVSLFSTMLW
LYYASLKSESSAFLLITVNSVGCALETIYIALYLAYAPKQARMMTLRLLLLNFGGYCSIL
LLSHFLTEGSARVQLVGWICVALSVAVFAAPLSVIKMVICTKSVEFMPFFLSLFLLLSAV
TWLLYGVFLKDLYVAGPNVLGVIFGVLQMALHAIYRKRNKAVTEEEKNDTSVGKLNSDIQ
SCKGHDLIIFIEASGKGPVATPSQV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A059A5R8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059A5R8_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 3.6% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059A5R8_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 4.2% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059A5R8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.2% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 104426118 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22