Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A059A5R8

dbSWEET id: dbswt_422

Accession:   A0A059A5R8

Uniprot status:   Unreviewed

Organism:   Eucalyptus grandis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.

Sequence Information back to top


Sequence length:   265

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A059A5R8|A0A059A5R8_EUCGR|Unreviewed|Eucalyptus_grandis|265
MAIFTTENPWVLIFGVLGNIISIVVFLAPVPTFCRICRTKSTEEFESVPYVVSLFSTMLW
LYYASLKSESSAFLLITVNSVGCALETIYIALYLAYAPKQARMMTLRLLLLNFGGYCSIL
LLSHFLTEGSARVQLVGWICVALSVAVFAAPLSVIKMVICTKSVEFMPFFLSLFLLLSAV
TWLLYGVFLKDLYVAGPNVLGVIFGVLQMALHAIYRKRNKAVTEEEKNDTSVGKLNSDIQ
SCKGHDLIIFIEASGKGPVATPSQV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   217

Alignment file: A0A059A5R8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A059A5R8_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    3.6% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A059A5R8_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.2% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A059A5R8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.2% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Gene ID:   104426118     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur