| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059A582
dbSWEET id: dbswt_140
Accession: A0A059A582
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 250
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A059A582|A0A059A582_EUCGR|Unreviewed|Eucalyptus_grandis|250
MAIFVHPHLWIFTFGILGNFVSFFVFLAPVPTFYKIYRNKLTEKFQSIPYLVALFSSMLW
LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYAPIAAKKSTIKLFALMNMGLFPLLIL
ITHFIPNDDARATVFGWICTTISVSVFAAPLSIVARVVRTNSVEFMPFSLSFFLTLSAIT
WFGYGFFQKDWCIMIPNIVGFVLGLSQMVLYGYYRNKEDIKDEIMDETLPQRAAVEVVVS
GNDPGSDQPS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: A0A059A582.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059A582_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.2% allowed 2.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059A582_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059A582_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.2% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 104425751 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA