| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A059A4Q4
dbSWEET id: dbswt_419
Accession: A0A059A4Q4
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 281
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSDS CVV: 342 CHI: -0.9
Fasta sequence:
>tr|A0A059A4Q4|A0A059A4Q4_EUCGR|Unreviewed|Eucalyptus_grandis|281
MVIFSTDNPWAFAFGLLGNIISFVVFLGPVPTFYGVCKRKSTEGLQSVPYVVSFLSAVPW
IYYACINSGSNNFLLIAVNSVGCVIEAIYVALYLAYAPKKAKIFTVKLMVMSLGGFCSFL
LLSHFLTKGPTRVQLLGWLCVGFSIIDFAAPLIVMRMVIRTQSVEFMPFSLSFFLTLSAI
TWLVHGIFLKDIHIVVPNVSGFILGVLQMGLYLIYRKRNVMVLEEPDYFGGAMPIVDAQS
CIIASNDSVIDVDEVKEGKDDVHEGEKSFEASDNGPVANSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A059A4Q4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A059A4Q4_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 4.3% allowed .5% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A059A4Q4_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.7% favored 3.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A059A4Q4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 3.8% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22