Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A058ZVA4

dbSWEET id: dbswt_692

Accession:   A0A058ZVA4

Uniprot status:   Unreviewed

Organism:   Eucalyptus grandis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.

Sequence Information back to top


Sequence length:   243

Substrate Binding Site:   CSWN           CVV:   418       CHI:   -2.7

Selectivity Filter:   LNMS           CVV:   417       CHI:   1.4

Fasta sequence:

>tr|A0A058ZVA4|A0A058ZVA4_EUCGR|Unreviewed|Eucalyptus_grandis|243
MRVLRFLIGVLGNAAGLFLFLAPVITFKRIIRSRSTEQFSGIPYVMALLNCLVFTWYGLP
FVSRNNLLVSTVSGIGGVIEFTYIVIFLIYAPKKERTKIIGLFSLIMTVFLVIASVSLLA
LHGNTRKLFCGIAAALFSTTMYASPLSVMRMVIKTKSVEYMPFFLSLFAFLSGVSWLTFG
LLSGDPFIIVPNGFGTGLGIAQLILYAIYCKSKSHTENTIKDDFTEMDLGKIDQAKKPDS
SHL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: A0A058ZVA4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A058ZVA4_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    2.7% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A058ZVA4_outward.pdb

Procheck score ⇒ Ramachandran plot: 96.2% favored    3.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A058ZVA4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    3.8% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur