Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A058ZVA4
dbSWEET id: dbswt_692
Accession: A0A058ZVA4
Uniprot status: Unreviewed
Organism: Eucalyptus grandis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Myrtales ⇒ Myrtaceae ⇒ Myrtoideae ⇒ Eucalypteae ⇒ Eucalyptus.
Sequence Information back to top
Sequence length: 243
Substrate Binding Site: CSWN CVV: 418 CHI: -2.7
Selectivity Filter: LNMS CVV: 417 CHI: 1.4
Fasta sequence:
>tr|A0A058ZVA4|A0A058ZVA4_EUCGR|Unreviewed|Eucalyptus_grandis|243
MRVLRFLIGVLGNAAGLFLFLAPVITFKRIIRSRSTEQFSGIPYVMALLNCLVFTWYGLP
FVSRNNLLVSTVSGIGGVIEFTYIVIFLIYAPKKERTKIIGLFSLIMTVFLVIASVSLLA
LHGNTRKLFCGIAAALFSTTMYASPLSVMRMVIKTKSVEYMPFFLSLFAFLSGVSWLTFG
LLSGDPFIIVPNGFGTGLGIAQLILYAIYCKSKSHTENTIKDDFTEMDLGKIDQAKKPDS
SHL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A058ZVA4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A058ZVA4_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 2.7% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A058ZVA4_outward.pdb
Procheck score ⇒ Ramachandran plot: 96.2% favored 3.3% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A058ZVA4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 3.8% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA