Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A044V4C3

dbSWEET id: dbswt_1001

Accession:   A0A044V4C3

Uniprot status:   Unreviewed

Organism:   Onchocerca volvulus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Filarioidea ⇒ Onchocercidae ⇒ Onchocerca.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   GNWN           CVV:   403       CHI:   -8.3

Selectivity Filter:   LSTV           CVV:   395       CHI:   6.5

Fasta sequence:

>tr|A0A044V4C3|A0A044V4C3_ONCVO|Unreviewed|Onchocerca_volvulus|228
MTVAHVEDAFPSQLLSWLSTLAVGTTVCLFLTGFEICWRIKSQGTTDGISSAPFHMGFLS
GQLWLQYGLLRNDKTVVCVNSVAALLYLFYLFYYFLMAPYATKNRCIRLIFLEVIFLMST
HYYIHYYGLPVEIVRSRLGMCCVIFNILTVAAPLEALREVLRTRCTETMPLPLCCLTLLV
TTEWLLYGILIDDIYIKVPNAIASVIAVAQLLPFFYFPRNKQTATIIP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   8     Model end:   219

Alignment file: A0A044V4C3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A044V4C3_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.8% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A044V4C3_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A044V4C3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur