Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A044T968

dbSWEET id: dbswt_999

Accession:   A0A044T968

Uniprot status:   Unreviewed

Organism:   Onchocerca volvulus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Filarioidea ⇒ Onchocercidae ⇒ Onchocerca.

Sequence Information back to top


Sequence length:   244

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   LGNV           CVV:   373       CHI:   4.1

Fasta sequence:

>tr|A0A044T968|A0A044T968_ONCVO|Unreviewed|Onchocerca_volvulus|244
MFTEFFRNLTLLKCLSVSAFITTVMLFFCGIPICVNIWKRRSTKDISAVPFLMGVLGAVY
WLRYGLIKMDYTMIAVNIFAATLMGIYLTFYYFMTEKKLWISIEVCAVIFLISLMLLLVQ
IFGHGVIHPLGFTCMTFNILNFGAPLAGLKVVLRQRNCETLPLPLCIANLLVSSQWALYG
VLISDIYIIIPNAIGMILAMIQIALFLVFPMKQGRLSLVQRCFGPSCCAIAASSPSSDEN
AAHT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: A0A044T968.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A044T968_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.4% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A044T968_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.5% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A044T968_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur