Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A034WPZ2
dbSWEET id: dbswt_998
Accession: A0A034WPZ2
Uniprot status: Unreviewed
Organism: Bactrocera dorsalis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Tephritoidea ⇒ Tephritidae ⇒ Bactrocera ⇒ Bactrocera.
Sequence Information back to top
Sequence length: 253
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|A0A034WPZ2|A0A034WPZ2_BACDO|Unreviewed|Bactrocera_dorsalis|253
MEALSNILAPYSHVLAKVAGTITTLQFLSVVILLNDIRKRGRSDGYPPEPFLGGVVLSIL
TLKMGTLMGDAATIKVNLLGITLSAVFLSIFYWYASSEFRGKILSKIGIAAAFTVACLAY
ATIENPKKIEFRFGMLVTGILVFLVGSPLLHLNKIIEKKSTEGMPFPIIFTGTLVAASWA
LYGISIHNFMMAYQNLFLFTLSAIQLSLFVIYPNSPSVSESSVKHSPSTLEHKTSQGKTS
SPSKTSVGSKKKN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: A0A034WPZ2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A034WPZ2_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 4.9% allowed 2.2% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A034WPZ2_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 6.6% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A034WPZ2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.0% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 105225913 Total Exons: 4 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5