Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A031HJQ3
dbSWEET id: dbswt_1301
Accession: A0A031HJQ3
Uniprot status: Unreviewed
Organism: Sphingomonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Sphingomonadales ⇒ Sphingomonadaceae ⇒ Sphingomonas.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A031HJQ3|A0A031HJQ3_9SPHN|Unreviewed|Sphingomonas|87
MTTERRAVHLLGWIATLTAVAMYVSYVSQIRLNLAGHKGSAIQPLCTMLNCSLWVTYGLV
KQRRDWPVTLANAPGVVLGLITFVTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A031HJQ3_inward.pdb Alignment file: A0A031HJQ3_inw.pir Procheck score ⇒ Ramachandran plot: 84.8% favored 13.6% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A031HJQ3_outward.pdb Alignment file: A0A031HJQ3_out.pir Procheck score ⇒ Ramachandran plot: 88.6% favored 8.3% allowed .8% week 2.3% disallowed Occluded: Model structure: A0A031HJQ3_occluded.pdb Alignment file: A0A031HJQ3_occ.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 1.5% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA